DPCstruct | MC9710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 114 ± 17 aa |
| Standard deviation of domain lengths | 17.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.72 |
| Pfam Score | 98.68 |
| Assigned Pfam label(s) | CL0465- CL0013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4P1I0 | 9-119 | LRMSCLELARSFLFLANRGQEPASGKRLLTVSQAKRLNALMLTCGFYDEAGEFAFRVGLPGKSGVGGGIAAILPGRWAVAVWSPEIN… |
| A0A511J912 | 190-306 | YFRQCAVLVSAHDLAAMAATLATGGTNPVTGERVLPEDVTRHVLSIMATCGMYDYSGRWMLTVGLPAKSGVSGGLIAVSPGKFGVGV… |
| A0A1Q8FRS1 | 298-415 | None |
| A0A061QGF4 | 129-252 | None |
| A0A7S4P409 | 501-613 | None |
| A0A645JKY0 | 4-98 | None |
| K1WRK1 | 3-67 | None |
| A0A7J6TST6 | 92-210 | None |
| A0A653XRC6 | 152-279 | None |
| V9KU06 | 173-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.