DPCstruct | MC971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 234 ± 24 aa |
| Standard deviation of domain lengths | 23.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A200R482 | 17-233 | SSNLWFADNPSKRWGEIFFLLYTPFWLTLVLGIVVPFKLYESFDELGYMLSASVSAVPSFLIPLIFVGKVDSGMRLKDRYWVKASLW… |
| A0A0E0BI73 | 17-260 | GAGRTSRWMAADGSKRWGETFFLLYTPFWLTLCLGVVVPFKLYERFTELEYLVVGLVSTVPAFVIPLFLVGKADSVRSLKDRYWVKA… |
| A0A812V6R7 | 247-474 | None |
| D8R170 | 6-245 | None |
| A0A5J4Z1A8 | 1-267 | None |
| M7ZAY9 | 141-384 | None |
| R7QAB2 | 11-264 | None |
| A0A3M2A8I1 | 7-242 | None |
| A0A0G4F061 | 44-306 | None |
| A0A4D9CVY4 | 73-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.