DPCstruct | MC9703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 84 ± 6 aa |
| Standard deviation of domain lengths | 5.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 86.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844H022 | 2-86 | HFFMLFVPVTGLWMSAIGVVGLGFNLRAYDFVSQELRAAEDPEFETFYTKNILLNEGLRAWMAPQDQPHEKFVFPEEVLPRGNAL |
| A0A510PIS5 | 71-155 | HFFMLFVPVTGLWMSAVGVVGLALNLRAYDFVSQELRAAEDPEFETFYTKNILLNEGLRAWMAPQDQPHENFIFPEEVLPRGNAL |
| A0A3P6EYI1 | 149-231 | None |
| A0A1R3KFH4 | 541-617 | None |
| A0A816J049 | 137-231 | None |
| A0A846D1W7 | 16-100 | None |
| Q108X8 | 192-276 | None |
| A0A5N6NVT4 | 46-141 | None |
| A0A445KYQ8 | 71-153 | None |
| A0A803N3J2 | 406-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.