DPCstruct | MC9700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 125 ± 20 aa |
| Standard deviation of domain lengths | 19.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 65.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834AP87 | 9-114 | PLARPILPRERGALDRIVEYLVGDGPQNRYALICQQCFSHNGMALKEEFEYIAFRCAYCFFLNPARKTRPQAPRLPEFSFEKRQAVE… |
| A0A0A9RXS8 | 1-126 | MVVEHHQGSGASDGGWIAKIVALLVAEDPSQSYALICGNCHMHNGLARKEDYPHITYYCPHCHALNTSKQSMGQYSGSNSGRSTPVV… |
| A0A4D9BLT9 | 1-90 | None |
| S2K1P2 | 202-305 | None |
| A0A2I0XEN8 | 28-169 | None |
| U3ILF3 | 107-239 | None |
| A0A834Z9T1 | 462-557 | None |
| A0A3M0LHL3 | 53-203 | None |
| A0A0M8MLE4 | 153-289 | None |
| A0A3Q7S4X5 | 98-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.