DPCstruct | MC970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 473 ± 51 aa |
| Standard deviation of domain lengths | 50.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1CTE1 | 1-475 | AARAIPRMLALAVPYVPVDTRVAHKVLKDPIASEIVEDIRSFRPTCVIIHAGLKPRQGCDAGAEVLDSIPTPILRIQDELIEALNDV… |
| A0A0E0AUK1 | 1-547 | MQELEYWTHHHPSKQSNMAPPLARLPPGDLPCDPDSTQNPSSGANAMSQTQHHPGRRRIRSKWMRPKTPKSSSSRSSSYESSSSSSA… |
| A0A7J6HXH6 | 1-500 | None |
| A0A5D3D6I3 | 7-499 | None |
| A0A3Q7JBC7 | 349-839 | None |
| A9TE17 | 1-423 | None |
| A0A0E0LVG7 | 73-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.