DPCstruct | MC97
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 224 ± 31 aa |
| Standard deviation of domain lengths | 30.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5J678 | 279-507 | RGQPANQKPATAPPPKFGHKGPPQPKFLSKTPTPLTTDALLQKDYFIIEGDQGFLENPGAKTFTDSADSLLALSDRVYRSIVSVERK… |
| A0A6J2XXH2 | 3-213 | SKVRDDPMWQEFEDDGLELMAYGRSRKFAVTLEGLQPLIDQTYNALSIESRYFNTFVPLSAFSYYVWSMAYARIVSLKKYERLDVDY… |
| A0A6H5G3L9 | 56-300 | None |
| A0A6J2Y4W9 | 52-317 | None |
| A0A6G0U6J6 | 1-182 | None |
| A0A821XJ51 | 3-210 | None |
| A0A1A9X6X7 | 84-289 | None |
| A0A7J6ZBI5 | 214-427 | None |
| A0A0L7R4V5 | 75-324 | None |
| A0A1Y1K5J2 | 22-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.