DPCstruct | MC9696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 105 ± 20 aa |
| Standard deviation of domain lengths | 19.69 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3D420 | 17-107 | HHPLVLQDLVIFIAQLQCTLLDIHAMLDYFKIVHPLLENPPSKPIHANPTWMGCFTSDTQICDELYMAGVHVWLFCDEQFISPTMNI… |
| A0A0C3PDQ0 | 1-81 | MFVAHLQHKILDIYALLEYIEYVYPLLLNPPSCPLQANSTWMGCFVRATEVCEALYFAGVPIWLVHSKEYIPLTMNIVHSV |
| B0D976 | 66-170 | None |
| A0A0C9YAD7 | 1-90 | None |
| A0A1J8PJ41 | 51-177 | None |
| A0A2H3AWX5 | 12-126 | None |
| B0D5J0 | 27-175 | None |
| A0A0C3PKQ9 | 4-111 | None |
| B0DR48 | 15-99 | None |
| A8NSZ3 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.