DPCstruct | MC9695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 303 ± 60 aa |
| Standard deviation of domain lengths | 59.56 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 73.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF21358- PF00067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8NJ40 | 23-321 | SDLAKLQKVGTTVYREVWTEFYKWEPDYCQQRIDSLADDESAAWVVTTKLSEMIDHNEPQVLDNEMDMDSPSCVFARANPDGTFTES… |
| A0A0D2LW59 | 9-291 | TMRSPGASDAGPPDLDDIIAQRETALRVYDDTRAAFAAWAQEHARTTLARLSRAPNRVPRPLPTPNPHAAWPRSEALFLPDSDSSAA… |
| A0A409XJX0 | 16-279 | None |
| M2P705 | 5-326 | None |
| E2LKS0 | 1-217 | None |
| A0A4Y9YJA9 | 1-241 | None |
| A0A4Y9XR14 | 509-805 | None |
| A0A284QQJ3 | 1-295 | None |
| A0A4Q2DV18 | 23-257 | None |
| A0A2G8RZC9 | 4-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.