DPCstruct | MC9694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 333 ± 17 aa |
| Standard deviation of domain lengths | 17.46 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 74.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R0RU69 | 128-463 | GAGSAPGSPPHEDVDGPSAKEPRDPSKKKRAKENGGDDDEKKDPAAADSVSRRIAAVLEIGLQPPLDETEIFRLVMYGRTSSVPSEE… |
| A0A0D2LGQ0 | 1-359 | MAEKLLEKAYNTVISLEPITPTASPSKREPYLARVNNYAKWISMMQSHVTEVLTASRVDDESTSESAGEDLVSKPQKKATITARVAS… |
| A0A369JH73 | 1-346 | None |
| A0A067PHT4 | 1-312 | None |
| A0A166ADX6 | 144-480 | None |
| A0A067NX88 | 186-520 | None |
| A0A165KHS9 | 127-465 | None |
| A0A165AQ71 | 1-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.