DPCstruct | MC9692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 805 ± 117 aa |
| Standard deviation of domain lengths | 116.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0CBY3 | 1-820 | MADKEFLENAFPSLREDLVPIEKYSNLDPLIIPEGEVTVSSPLRTASDIDSQMQAVIQLLPDDDSDTQVVVGFDAKYNVEVSSRGHV… |
| A0A0D2L5Y9 | 242-1170 | EMDEWIGKQYPSFLPFNDTSTDGPRNFVPSAQWLRDLYDMFIEEHQQDFNQHMALLSAEITKHIATVNGERVFTALLTVTNQNGQIR… |
| K0R618 | 2-682 | None |
| A0A284RYK3 | 2-841 | None |
| A0A1C7MLS5 | 2-572 | None |
| A0A4Z0AD06 | 3-720 | None |
| A0A6A4GEN5 | 239-1220 | None |
| A0A0D0C6W1 | 42-913 | None |
| A0A401GA37 | 2-721 | None |
| A0A0D0BA31 | 20-936 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.