DPCstruct | MC9691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 169 ± 29 aa |
| Standard deviation of domain lengths | 29.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3LZD5 | 1-143 | MLPVNVIVKPLNDWDEHFLSCWATHPHYARDLIWAPKKYPCTTLALATESMPLLPSLPDYEFVNSAALKTIEKYPHLFKIVMPIKVS… |
| A0A0D2KR73 | 13-193 | QSQVEHGGTTEPKPRSASASMAQAGAGGNAAIDMFAKFAKNPDTEKKPVMVARSEQYGLNPKYLRHNVWDEKSVSLPFSMSQWTETA… |
| A0A4Z0A571 | 122-290 | None |
| A0A0C9XES4 | 90-252 | None |
| A0A0D7AQC0 | 100-256 | None |
| A0A0C9WGU8 | 19-214 | None |
| A0A284S1D5 | 10-192 | None |
| A0A4V3XEW2 | 37-199 | None |
| A0A0C9VI92 | 259-421 | None |
| A0A0C9USU6 | 348-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.