DPCstruct | MC9690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849HB64 | 187-266 | VSGITIDATALTGNNLRIDPGMGSHSAETPVTLDLPTGTYNLVSGNGAVTFSVSEAGRVDYASGLDLVLEGRGTRHLTVL |
| A0A428YW00 | 3-85 | GLPVTVDVTSLKASIFSMSQVLSAASTRERHLVRVLPTRYQLSDGTTWSQAYFTVTGSGQVQYDQSATYLSGSGSQTLRTATA |
| K1ABD5 | 40-152 | None |
| A0A7C9JH98 | 822-900 | None |
| A0A532CUY9 | 263-365 | None |
| A0A1V2PPN0 | 508-597 | None |
| A0A1W9GXA3 | 1-84 | None |
| M3CBU4 | 177-258 | None |
| A0A849U534 | 78-175 | None |
| A0A533XRU1 | 34-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.