DPCstruct | MC969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 429 ± 109 aa |
| Standard deviation of domain lengths | 109.42 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12222 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534KJ87 | 2-332 | RVVLELFAKGNSCDEFWYGSEPDAYADANGLCGGGAFREIQVTVDGTLAGVVWPFPYIFTGGVNPFLWRPIAAVGAYNEDPYQVDLT… |
| A0A2P2HPL3 | 290-778 | WLIPPECEFDTVKINLTVTSQGRQFDRLAILFLGDTEVFRTSTAEPTADGIVWAYIKDMSQYNALWQIQQKLIFDLGNIINDIYTGP… |
| A0A4D4LJX9 | 1-289 | None |
| A0A094HRT3 | 460-993 | None |
| A0A0B2SUN4 | 5-254 | None |
| A9RNJ4 | 235-577 | None |
| M8CAY7 | 26-437 | None |
| A0A662Y4I1 | 60-584 | None |
| A0A0N0NRR9 | 265-682 | None |
| Q0JPR4 | 1-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.