DPCstruct | MC9689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 238 ± 22 aa |
| Standard deviation of domain lengths | 21.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12721 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N7F458 | 45-285 | VGVVLRTVSGVRVSNSRGVVVGNDCRLRNRDHYHVEYVTVDPEPLTTLLEEHAGARSALRELAGQPGSRAAIRRFQRAIAPPRAEEP… |
| A0A428YSQ3 | 5-217 | HTVHARESTSVVTGDHCELTRVDHVHIRQAVVAQDDALRSAEVSEIVARAGPGRDNAGVVHELRRTLNDLVERPAPAGRTTMSRQLR… |
| A0A810LFH9 | 181-397 | None |
| A0A8B0DSC6 | 119-376 | None |
| A0A2T3VNZ1 | 51-290 | None |
| A0A550HAA4 | 2-260 | None |
| A0A0S4QMP5 | 41-239 | None |
| C9YZ74 | 1-259 | None |
| A0A6N9XPY9 | 1-264 | None |
| A0A1C4WYQ5 | 175-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.