DPCstruct | MC9688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 277 ± 49 aa |
| Standard deviation of domain lengths | 49.48 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15461 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5R1NL52 | 7-236 | FGTRYPAWRTGFTAVYILVVVGVMLLWLVAPVASLAAFLLVSALHFGSDWNSDRSVWLRFLAGFGLLTVPALSHPDQVSAIYVVLAG… |
| A0A265UWU5 | 7-288 | NLVSTVFLLWLTIQIESAYEEYLAYFFILTVGIVHGANDVSLISFITKSRGMSKNKYLISYIAIIIVMSIAFFQFPFLALLIFILFS… |
| A0A507FIQ9 | 1-420 | None |
| V4YT67 | 19-318 | None |
| K7QXH0 | 3-243 | None |
| A0A4Q0YNU2 | 24-261 | None |
| A0A2E3NLK5 | 45-314 | None |
| A0A4V1ZVL6 | 17-256 | None |
| A0A3D1FXR6 | 140-410 | None |
| A0A3E0VRY9 | 18-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.