DPCstruct | MC9686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 128 ± 6 aa |
| Standard deviation of domain lengths | 5.95 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3NGG1 | 2-132 | AEEFDELHIIKNNFYVGNYPLVINDNTNPSTPQGRLEKQCLIFRSLIALKQYQKIIEEVNDNHPEEFCAIKLLAQYLSAKENNNKGD… |
| B1WBX7 | 10-131 | SGSSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPEREVERDVFLYRAYLAQRKYGVVLDEIKPSSAPELQAVRMFAEYLASENR… |
| A0A4D9BBL9 | 298-419 | None |
| A0A2U1PI82 | 2-128 | None |
| A0A0B0N4E3 | 39-165 | None |
| A0A2A6CZR5 | 1-125 | None |
| X6NTW1 | 93-231 | None |
| A0A6A3B6T2 | 1-135 | None |
| A0A2H5N0Q0 | 1-129 | None |
| A0A6J2VCU1 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.