DPCstruct | MC9683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 93 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A238F394 | 2-84 | EPAYRGFIETTLDALLIFEGCRRQQLTQITRRLSENEKRDLITSGAIFVFDEEDTGIKRWTDGLTWSPSRTLGNFLIYRELDK |
| A0A1Y3NCM4 | 8-94 | KLVETFYGFIENPKDGLILFQAVKDGLLPSVQRRLSVEQRIQIKSGSVFVFNETESNIKRWTDGRTWTPSRVQGDFLIYRELEKNID |
| A0A2C5XGE2 | 148-252 | None |
| A0A284QVZ6 | 1-89 | None |
| A0A0D2P2W1 | 72-167 | None |
| A0A7I9EKD1 | 2-90 | None |
| A0A0H2RVX0 | 2-87 | None |
| A0A2U3DNY9 | 2-81 | None |
| A0A146HXZ8 | 246-350 | None |
| A0A507F7B6 | 38-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.