DPCstruct | MC9682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 314 ± 57 aa |
| Standard deviation of domain lengths | 57.02 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 16.26 |
| Pfam Score | 77.17 |
| Assigned Pfam label(s) | CL0192- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A8RPU1 | 1-247 | MTVNNCSFINNSAYYGGAIDNSHGTLTVTNCTFTKNKGTSGGALCNMYGSMVVDNCTFTNNNGVSGGAIYNLGDLSVKHSTLLKNTA… |
| A0A1Y3NBF0 | 9-362 | VNILNSTFINNKSDHNGGAICIDNISNLDLNIISNTFIKNEGINGGAIYLYDNNKSLSKKNGDKQYFDYTININDNTFKENLAHNYG… |
| A0A1X7SUX7 | 98-409 | None |
| A0A1X7SSQ3 | 19-443 | None |
| A0A1X7SQU4 | 193-502 | None |
| A0A1X7SP18 | 71-339 | None |
| A0A1X7SIZ7 | 5-326 | None |
| A0A482ZQ39 | 1-283 | None |
| A0A843F8N5 | 102-370 | None |
| F4PY44 | 170-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.