DPCstruct | MC968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 119 ± 17 aa |
| Standard deviation of domain lengths | 16.69 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 30.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0225 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5FPX1 | 80-182 | NTGKFIRDLLSGRFLTGDGITSHIPYLLFVTGIFLVYISLGYHFENIEREKMKTEQRLEEVTSEYKTLRSELESILQQSRVERATAD… |
| A0A7Y5C3M4 | 3-126 | EKEIKNNEPKKEEKKSSVTRSLSGIFTGNFLTKKNVLNQLPFIFFLSAIGIAYIANGYYAEKTVIELNKVTNDIKELRSEYITLKSE… |
| A0A7X8J3A9 | 17-122 | None |
| A0A0R2R8H4 | 12-115 | None |
| A0A1W9SQ74 | 1-106 | None |
| A0A7Y4XMQ8 | 5-106 | None |
| A0A7K3WPL1 | 1-119 | None |
| A0A136N128 | 9-107 | None |
| A0A522EZ89 | 14-140 | None |
| A0A3B9TAA0 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.