DPCstruct | MC9679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 160 ± 12 aa |
| Standard deviation of domain lengths | 11.75 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0J6R5 | 272-437 | VQALVLLAEILAPLLDMVYRSDEKEKAVPLISRLMYYVFPYLKNHSAYNMPSFEAGSQLLSSLTGYAYTKRAWKKEVFELFMDPLFF… |
| A0A1Y3N5F4 | 16-180 | VEIVMYISTVVFPIIRKILIDQEKVITVCNNINYYIISNVFKNRNEETIALVVTLDLMIEMMKLSYTHRCYRKEIWEMFYNGKFFKM… |
| L9KY42 | 27-179 | None |
| A0A3B3Y5C1 | 206-372 | None |
| U9SFK6 | 13-181 | None |
| A0A5S6PSF9 | 2058-2228 | None |
| A0A183R189 | 455-606 | None |
| A0A183SWM6 | 2-164 | None |
| C3ZLF7 | 141-314 | None |
| A0A669E576 | 960-1118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.