DPCstruct | MC9677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 448 ± 59 aa |
| Standard deviation of domain lengths | 58.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 18.37 |
| Pfam Score | 44.44 |
| Assigned Pfam label(s) | CL0192- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3MTR7 | 3-505 | SFNNIKLFNVTTISKPIFNVLRKSFNISNAEIKYLYGTNDVSSATLINYNSESNIATMNIVNATISYCYSNNPLIKISAENYNSIKL… |
| A0A1Y3N2H3 | 1-382 | MKLENIKTNFKAVFHSVAKNYFIDNLIVKNVMVNGDENASSLILLNSAESSVEIKNINFNNNKNINKMECGNLYFENDVAISISDSI… |
| A0A843EFM6 | 3-448 | None |
| A0A077ZW18 | 2-424 | None |
| A0A1Y1XP06 | 3-413 | None |
| A0A1Y1XPZ1 | 484-895 | None |
| A0A1Y1V2B7 | 3-435 | None |
| A0A1Y1V2R7 | 470-892 | None |
| A0A1Y1V8P3 | 43-602 | None |
| A0A1Y1VE40 | 308-807 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.