DPCstruct | MC9676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 178 ± 33 aa |
| Standard deviation of domain lengths | 33.27 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18784- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9HUU6 | 44-198 | GPLMERRNKGNVLKALQYLLLISEVDETEIFKICLEYWNALAADLYREMLMTKTSNTASSARCVFYQTVLSRLRYIIISRMAKPEEV… |
| A0A1Y3MWL3 | 23-183 | HVKIIEARGQRDLLLTGHWYLLRISLVRDREIFKICLEYWAKLVAELYEEIQRIPHVNIPLLNMGQNGMGSYNYDDIPLRKHIYKEV… |
| A0A836DAZ6 | 146-329 | None |
| A0A453MKM5 | 143-296 | None |
| A0A453MKK8 | 8-172 | None |
| A0A7S7LHW1 | 332-616 | None |
| A0A7J7IJG7 | 8-179 | None |
| A0A0D0AZ97 | 43-240 | None |
| U6MA50 | 196-366 | None |
| A5B4Q1 | 158-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.