DPCstruct | MC9674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 158 ± 34 aa |
| Standard deviation of domain lengths | 33.77 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 24.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1X8D8 | 100-249 | TRILSKEEVLKIRNKYYISYYCKDDICVPSSYNYMGKTIEIPNKNGTLIKYITNTCRYEEIKTNNCNSNILCNNDFECLSNKCFNNY… |
| A0A1Y3MV74 | 23-179 | YTFYCIDDNCQPDRNFDSPFFEYTETNGNVTKYIKRICPKESAEGGKCTTEKCTTDSDCMSNKCFNGVCVSENNSSSPSIFTECSDV… |
| A0A1Y1WXL4 | 183-313 | None |
| A0A1Y1WXF3 | 8-124 | None |
| A0A1Y1WX55 | 51-223 | None |
| A0A1Y1WSM2 | 6-186 | None |
| A0A1Y1WSG2 | 12-193 | None |
| A0A1Y1WRU6 | 31-220 | None |
| A0A1Y1V4A2 | 43-232 | None |
| A0A1Y1V7Z6 | 10-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.