DPCstruct | MC9672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 151 ± 17 aa |
| Standard deviation of domain lengths | 16.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1VH16 | 21-181 | KYVNAKLIKVKNNDDNFYNLKNLINNNQDEELIINFVDDYYNMTLIEAFSIDISLINNVSLIGNINGTVFDYNHQGRKGPFKFSTEY… |
| A0A1Y3MT35 | 35-198 | EINISIPNEDYNIYNINELVSYYSIKYNNINIYLKDHYFKHDGEKKGFSITVPGNTNVSIIGNPNNGTIIDFSKNIFYYSILFNEYT… |
| A0A1Y3NPW9 | 18-157 | None |
| A0A1Y3NKY1 | 10-150 | None |
| A0A1Y1VIT4 | 1-124 | None |
| A0A1Y1VIH0 | 22-184 | None |
| A0A1Y1VE40 | 18-178 | None |
| A0A1Y1UXI5 | 25-181 | None |
| A0A1Y3NEK0 | 86-246 | None |
| A0A1Y3NDM5 | 434-597 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.