DPCstruct | MC9668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 103 ± 14 aa |
| Standard deviation of domain lengths | 13.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.97 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 48.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19861 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9REV0 | 47-135 | EARLNQHNATSPELTGGDVDAYWEGANAVGDEAVGGTVATPDKNVTEELGKAVGLEMEDRQPLQTNDILDRRDDERWELDPKSSEDY… |
| A0A7T9GF25 | 11-130 | YVDTGDMESEIFEPDDEVKEEFAEASRLGDTGRLRSPEGSPTLSGGDIDAAWDQADASGEETVGGSSPTPDQDVVDELGEAVGLTYR… |
| A0A7W1YRB2 | 108-236 | None |
| A0A3N5S3C7 | 106-202 | None |
| A0A1Q7NAN4 | 1-91 | None |
| A0A1F2THB5 | 38-149 | None |
| A0A2V6PYM7 | 33-130 | None |
| A0A846E3D1 | 18-111 | None |
| A0A0K2GD09 | 24-130 | None |
| A0A2E0ZIE1 | 91-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.