DPCstruct | MC9666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 137 ± 11 aa |
| Standard deviation of domain lengths | 11.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0QD24 | 1-148 | MKQLTNAAILCILFFSSVQAQPSEQKAIEFAKRLSVSLLDSTLPQARFSEWLAGLVGDSAIVQWELNDCGEQTGDSAIDNHRDIPIC… |
| A0A7T9GEU1 | 1-123 | MSDEELIGYAKKLNVNKIESRLPQQELNEWLKSILKSTTSIEWEINDCGEQTGTEIDRERDLPFCAGIEAKTKDGGKVILAILIGTD… |
| A0A7Y4YNT0 | 201-333 | None |
| A0A538SAW0 | 38-178 | None |
| A0A444JFY2 | 1-151 | None |
| A0A2U3L4S8 | 36-164 | None |
| A0A7W0LC34 | 163-286 | None |
| A0A0F9M062 | 153-304 | None |
| A0A6N7AU10 | 173-294 | None |
| A0A2V9Q5W4 | 11-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.