DPCstruct | MC9665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 119 ± 11 aa |
| Standard deviation of domain lengths | 11.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7WTD2 | 1-130 | MSGGLSHIDSFDPKPRLAAEAGRPMPFQTERTMFNEDGNILPSPWEFTRYGQSGIPVSALFPHIGSVADELTIIRSMTAPFMEHAQA… |
| A0A2H6AFF3 | 66-191 | MNGGPAQMDLWDYKPKMREWFDKDLPPSVRGNQRLTTMTSGQARFPIAPSRFNFERHGKSGIWVSELLPWTAKVVDELCIIKSMHTE… |
| A0A812TRG9 | 168-294 | None |
| A0A388PKC0 | 68-195 | None |
| A0A7C7Z897 | 45-168 | None |
| A0A7C7Z855 | 1-114 | None |
| A0A2E8GL43 | 59-146 | None |
| A0A517RC34 | 60-171 | None |
| A0A812LYU4 | 765-887 | None |
| A0A6N6PIS4 | 7-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.