DPCstruct | MC9663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 6.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 32.12 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0161- CL0183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1SL71 | 221-297 | EKEARQAFLLELSDALRPLDDPADIQLAAATALGKRVGANRVAYGEDTGDGETYIVSPNYVDGAPDMSGIFRYADYG |
| A0A5C4N7K1 | 83-158 | ESEERQAFLLALSDALGALVTPLEIAAVATARLCEHLGVDRVLYGEIAGDRLTVERDHTRGVPSLVGEHSLKPFGP |
| A0A7R7BAB2 | 3-78 | None |
| A0A162JEN7 | 145-237 | None |
| A0A1G7JF49 | 153-233 | None |
| A0A6N8FRF0 | 628-717 | None |
| A0A0Q4NS80 | 62-140 | None |
| B3QJS5 | 67-142 | None |
| A0A495EXT2 | 12-100 | None |
| A0A512C2J7 | 152-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.