DPCstruct | MC9661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Standard deviation of domain lengths | 14.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 94.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1B0I9 | 51-197 | GTQINCSGGPMPWASWVTCEETVNGDDVGPDFTGQPNTGLQKHGYIYEVPVGRTVVGTPIRSAGRFAHESVAWDRVSRALYMSEDNF… |
| M4RQF8 | 3-107 | LIGTIRNCPGGITPWNSWLTCEESVLKASDEIGRNHGYVFEVPANTASLVKAKPILEMGRFNHEAAAVDPHTNIIYLTEDRNDSLLY… |
| A0A2E7VDU0 | 139-251 | None |
| A0A7W0TSR8 | 112-229 | None |
| A0A363UNM4 | 147-247 | None |
| A3U8R1 | 137-251 | None |
| A0A369TAL7 | 147-269 | None |
| A0A1I4JLD3 | 183-309 | None |
| A0A2E0YWZ8 | 159-266 | None |
| V7ZE41 | 181-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.