DPCstruct | MC9660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1076 |
|---|---|
| Mean domain length (aa) | 197 ± 57 aa |
| Standard deviation of domain lengths | 56.73 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 87.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.98 |
| Pfam Score | 95.36 |
| Assigned Pfam label(s) | CL0126- CL0094- PF12589- CL0123- CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846KKE6 | 2-118 | RSQIISEIRRYLDGNGYIEVETPVLHNEAGGAAARPFITHHNALDIDLYLRIALELHLKRLIVGGMEKVYEIGRVFRNEGIDTTHNP… |
| M4RM69 | 4-188 | LLVAMLDLHTQEHGYEETNVPLLVNQESMTGTGQFPKFMGDSFHTKPVTEEGQGLSLIPTSEVPLANIARDEIYAIKDLPLKMTAFS… |
| A0A4Y7J4D3 | 193-328 | None |
| A0A4Y7J054 | 690-959 | None |
| A0A2K4ISN8 | 3-136 | None |
| W1I4V0 | 67-205 | None |
| E7FA20 | 1253-1391 | None |
| A0A4Y7L6D7 | 440-567 | None |
| A0A2B4S5N4 | 1-251 | None |
| A0A1B8EKK2 | 186-449 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.