DPCstruct | MC966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 140 ± 14 aa |
| Standard deviation of domain lengths | 13.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0BUZ3 | 2-118 | RFLAYGAGVALMAIGARGLFLHVPDLLGWAKWVVGAVVLHDAVLAPAVLLAGAVTARRHVLQGALAVGGVITLVALPMVLRLGRHPD… |
| A0A1K1QVE9 | 1-148 | MRTARALLALPGLAALAWGVVLFARYALPLRPDVFGTIGWIVGGPLANDGVIVPLTAVFGMLLGRLLPHPWRVPVVTGTVLTGVLLI… |
| A0A428Z6A8 | 2-106 | None |
| A0A359F7R4 | 37-183 | None |
| A0A4Q7KEM4 | 2-139 | None |
| A0A556CQ25 | 1-159 | None |
| A0A5P2A5D7 | 1-134 | None |
| A0A1N7DM03 | 4-140 | None |
| A0A386ZFH6 | 2-149 | None |
| A0A1Q4Y1D6 | 1-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.