DPCstruct | MC9659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 7.07 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2TF87 | 134-232 | VFHAVLDRIRSEGALRAADFEYNGPKRGSWWDWKPAKTALEHHFAIGDLMISERVNFQRVYDLTERVLPAWVDTCEPTTEERDRRWI… |
| K6ZUA5 | 1-88 | MRRIQQEGPLRAKDFEQNSTQRGSGCRDWKPDKVTLEQLFIEGELMLAERIVFQKVYDLIKRVLPSCIVTTMSIAKEFERYLIMDYPT |
| A0A2D8U406 | 3-99 | None |
| A0A3B9GL88 | 71-167 | None |
| A0A812ZEE8 | 122-214 | None |
| U3TPY8 | 50-162 | None |
| A0A419EWQ9 | 128-221 | None |
| A0A7J7BT50 | 268-363 | None |
| A0A7W8LML1 | 87-169 | None |
| A0A447T4Y3 | 23-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.