DPCstruct | MC9653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 83 ± 15 aa |
| Standard deviation of domain lengths | 14.93 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 48.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4UG72 | 28-117 | LAMLLSNLIYITYIHCLFTTVSCIGFFGIPGDYCRIRSPTCCPNRDDDCTMPILGNHLCYCDVFCDRVDSNDCCPDFKEVCLGELPL… |
| A0A3Q4GXQ0 | 2-102 | KLILLTVTVLLLVVGEGTADRILSRRTKRELASPLHVGGIRDPFGSYCQRRGGCCPGRDDLCTVPYLDTICYCDLFCNRTVSDCCPD… |
| B4DK04 | 20-98 | None |
| L9JHT2 | 589-657 | None |
| A0A4Q8K125 | 5-89 | None |
| G0P7Q9 | 14-82 | None |
| A0A4C1UEZ5 | 38-120 | None |
| A0A7R9DPS5 | 6-81 | None |
| A0A1E1WMM7 | 9-86 | None |
| W2T3W0 | 133-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.