DPCstruct | MC9652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 115 |
|---|---|
| Mean domain length (aa) | 57 ± 6 aa |
| Standard deviation of domain lengths | 6.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.82 |
| Pfam Score | 93.48 |
| Assigned Pfam label(s) | CL0213- CL0126- CL0056- CL0226- CL0602 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1P9I0 | 42-87 | DFAPCFFPFTYDHNLYHSCTTHGSFIKRAWCSVTANYDKDRAWKHC |
| A0A3Q4GXE3 | 22-78 | LGNGAGRPCMFPFYYESNWYSECTAIDSPGNRKWCAVETKYDHGQFWGYCPTNCKYT |
| A0A6P6BS52 | 192-237 | None |
| A0A821R6R8 | 4-44 | None |
| A0A7M5WX32 | 549-601 | None |
| A0A1I8ICH7 | 21-81 | None |
| B4DUY7 | 124-168 | None |
| A0A3Q7T1C8 | 34-89 | None |
| B0S602 | 399-458 | None |
| E7FBB7 | 143-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.