DPCstruct | MC9651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 221 |
|---|---|
| Mean domain length (aa) | 116 ± 20 aa |
| Standard deviation of domain lengths | 20.16 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.53 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | CL0220- PF16880- PF12761 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q4GMV8 | 12-121 | NWVVPVADREKYKEIFKNTDTDNDGLVNGGDVIELFMNCTLSQTMLAQIWGLADTKQTGKLNEEQFALAMHLIQQKVNKGIDPPSTL… |
| A0A7J5XPK5 | 351-443 | EWVVGRDKPTYDEIFYTLSPINGKVSGAAAKKEMLKSKLPNTVLGKIWKLADVDKDGLLDDDEFALANHLIKVKLEGHELPAALPEH… |
| A0A7S2SL29 | 171-288 | None |
| A0A1A8YMQ8 | 51-159 | None |
| A0A5N5TMS5 | 7-107 | None |
| A0A4Y7NJV3 | 183-294 | None |
| A0A0L9V9Q9 | 5-138 | None |
| M9LY47 | 265-402 | None |
| A0A7R9Q834 | 188-283 | None |
| A0A1L1SRE4 | 4-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.