DPCstruct | MC965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 74 ± 1 aa |
| Standard deviation of domain lengths | 1.22 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 73.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 67.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A2WJX9 | 1-75 | MADRDPEAIKRDIDLARDQLAATVDSLAERANPRRLADDLKARAVEFVKKPVVIASLVGISSVVVIVVVRRVRDR |
| A0A2S7NDH6 | 1-73 | MADRDPDTIKAEIDQAREQLAITVDSLAERANPRRVADDVKAGVIRFVSKPPVAISLAGAGVLLLVLTIRRIR |
| A0A1A1WZT5 | 1-75 | None |
| A0A557XZI1 | 1-75 | None |
| A0A5Q5BN45 | 1-71 | None |
| A0A1X0DXI7 | 1-75 | None |
| A0A1P8XDF0 | 1-73 | None |
| K0V153 | 1-73 | None |
| A0A5P8ZSW8 | 1-74 | None |
| A0A1X1Y999 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.