DPCstruct | MC9649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 58 ± 3 aa |
| Standard deviation of domain lengths | 3.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4CJ30 | 1-57 | MRLICPRCNAQYEIDAGAVPLAGRDVECSACDHVWRAMPDAEDFDAGARPQLSRRLS |
| A0A3D8PAB4 | 1-62 | MRLTCPRCAAQYEIAQSAIPALGREVECSACGHVWREAGPRKSGPSGAAGPGRPADPDAARS |
| A0A353V1V5 | 1-56 | None |
| A0A2Z4PB02 | 83-139 | None |
| A0A1H9G458 | 4-65 | None |
| A0A4T1ZTF8 | 1-54 | None |
| A0A3D0UVY0 | 1-56 | None |
| A0A017HD35 | 1-57 | None |
| A0A1H3AM75 | 1-63 | None |
| A0A6A7M5P7 | 1-53 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.