DPCstruct | MC9647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 132 ± 20 aa |
| Standard deviation of domain lengths | 19.96 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M3AYQ8 | 80-171 | PATVGPYQDIRATLTQSYSAVQMDAQPDGPLKENMRASQQIALSTGVDDDGLFVFNFDDERYLPFEGTGAISRWTLSFSNPASQRDM… |
| A0A2S8QWB6 | 1-130 | MGPYQDIKATLTQTKSYTLKTPDINGVKYLLSNKEGDNKQIVTNLRASQQIALSSGINDSGTFNLNFGDDRYLPFEGTGAVSDWKLT… |
| A0A849EWZ7 | 848-970 | None |
| A0A7Y5J661 | 682-807 | None |
| A0A5E7ILE2 | 461-551 | None |
| A0A1H3JP59 | 309-436 | None |
| A0A2V5WIN1 | 15-172 | None |
| A0A5C4RKX6 | 9-160 | None |
| A0A0D8LA53 | 146-284 | None |
| A0A6L9JFN4 | 70-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.