DPCstruct | MC9646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 155 ± 24 aa |
| Standard deviation of domain lengths | 24.49 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U3BZN0 | 16-166 | IFMLGFMFIISLAATILFLRIPRMADLYFDRQRQIVYTWRNGKVAACHFDNLGYRETVYGLDLFLYREHKKKQYWPTRVTVQPTGRV… |
| A0A2S8QRW6 | 2-157 | IFLLLYLLIIPPFVWAIFFLRRQAPLIIDRERQIFYTWYKGKAYAARYPQVGMAEKTNILFLKVYGLDENNQLIGRGFIPNVSSYSF… |
| W1IXR5 | 1-105 | None |
| A0A2D0KSH6 | 2-135 | None |
| D3UWD3 | 20-175 | None |
| A0A2D0K915 | 149-325 | None |
| G9Y2X0 | 33-185 | None |
| A0A2D0J713 | 1-106 | None |
| G7EBH4 | 29-190 | None |
| S6GEX6 | 140-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.