DPCstruct | MC9645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 144 ± 10 aa |
| Standard deviation of domain lengths | 10.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G0VLH7 | 52-203 | QSVRIATQSIGLIAGGLQVTGGVGICVGSIGWMCAPAAIVIGHGLNNLYENGNNLLEGRSDTEGWGRVPYQAISEYFSGSKTAGNIA… |
| A0A2S8QPB3 | 16-146 | LTLKQIGFVSGGSQIFAGLGVCVASLGAACAGFGVPLLIQGGNNVYENGYYLLLRKEVSGPVRDVYRDAAKTLGYSGADGDRVYGYV… |
| A0A0U1H8N6 | 24-168 | None |
| A0A1H0LHY6 | 92-236 | None |
| A0A077FFP0 | 6-123 | None |
| A0A242NHK1 | 2-152 | None |
| A0A530MBX4 | 22-172 | None |
| A0A844X506 | 1-146 | None |
| A0A370QM09 | 59-210 | None |
| A0A378Q084 | 2-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.