DPCstruct | MC9642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 161 ± 18 aa |
| Standard deviation of domain lengths | 18.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9CJ15 | 8-164 | SSSIIPPTAAPTTPPDSSLFSQRSRRQFGLFMGGAAFFALSAAITRRSLVRKYKSLLPKFYTPSNHVPEFEGSMEALEALSVATVNV… |
| A0A6L0Z7C2 | 5-132 | KKERKKRRVLQMARFYGAAAFTLITMRLISRAIKVRKYVPSIFQQNYKLPPFSQRNEAMSALTYASAASIGTFSTLIFGFCWALDIS… |
| A0A3N4K0I1 | 21-182 | None |
| A0A421J4K0 | 407-554 | None |
| A0A5N6K8H2 | 239-394 | None |
| A0A517KXL3 | 2-167 | None |
| G4U8M2 | 30-225 | None |
| C4JXU5 | 123-297 | None |
| L7IUG5 | 58-193 | None |
| A0A2N6N935 | 39-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.