DPCstruct | MC9641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 479 ± 95 aa |
| Standard deviation of domain lengths | 94.61 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.15 |
| Pfam Score | 89.23 |
| Assigned Pfam label(s) | PF14330- PF07287 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1ACW3 | 148-598 | TVRIAAGQGFWGDWLEAPVRQVRGGPIDYLMMDYLAEVTMSILQKQKSRDPAAGYARDFVPLMERILPDVVERGIKITSNAGGVNPR… |
| W9CGR6 | 45-532 | LMFVISLIHSDQELTLFQGDPAYRMYEQLSLGDVDFITGDYLAEMNMAENTEAYRSGKHPGYISTALEGLSQSLELLAEKKTKVIIN… |
| A0A0G4KQJ7 | 1-353 | None |
| A0A257V301 | 10-298 | None |
| R1GU49 | 13-479 | None |
| R1G5J4 | 7-327 | None |
| A0A100J341 | 15-542 | None |
| A0A7I4EMV2 | 1-325 | None |
| A0A438NB83 | 352-920 | None |
| A0A2W6AVT5 | 24-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.