DPCstruct | MC9640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 107 ± 12 aa |
| Standard deviation of domain lengths | 11.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 30.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20521 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9C5S1 | 77-186 | ASILVQAAKTIGASIKALSDDGSCSKSEGSLDGLSWVYYATGRNCDTTAEAATIQGAIKQHLQTTDGSVLCGMECLDLTHSGTWSGF… |
| A0A1V6NXU5 | 231-329 | TKFSDANKSQPVILGIANKMYQQSQAGSCSSVTGTLQDYNGVSYSYYFYASGRNCDTTAQIKTMVSALDDAWDGLGSTSALCLTMQH… |
| A0A1L7TD28 | 93-192 | None |
| A0A0S7DQC4 | 54-160 | None |
| A0A2D3UTL5 | 5-109 | None |
| H2AXZ9 | 90-225 | None |
| A0A1V6RSV4 | 44-154 | None |
| A0A1E4SCM2 | 100-209 | None |
| W7MRM8 | 204-342 | None |
| Q4WF48 | 78-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.