DPCstruct | MC964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 124 ± 19 aa |
| Standard deviation of domain lengths | 18.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q3EVZ1 | 2-103 | NRHAKAATNPKYLYWLKKTALERLIAEKKAIKEGLHFSRNPRFSQQQSDVLIRLGDYFFHIPPTKEDFRILPHLGHLESSYRNPKTT… |
| A0A1S2LP81 | 15-145 | SIQHALYSVNRHAKTAIVKRDLYDIKNNTLQKLIKIGHAKKLWLEYSTQPGKAKQSTVVLVKVGIKTKGNPHFFHMIPEKEDYITLK… |
| A0A0D0RRC3 | 8-137 | None |
| A0A0A5GCR5 | 7-126 | None |
| A0A2G7M590 | 11-150 | None |
| W7C8I1 | 1-97 | None |
| A0A174TI83 | 219-357 | None |
| A0A150KAK5 | 5-96 | None |
| A0A3N6BUW5 | 7-131 | None |
| A0A239R708 | 142-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.