DPCstruct | MC9639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 331 ± 62 aa |
| Standard deviation of domain lengths | 61.71 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.27 |
| Pfam Score | 79.78 |
| Assigned Pfam label(s) | PF20695- PF01977- PF20696 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9C5K1 | 58-377 | NKLFGDEFDLNSLPSPFIHQTDGGKYIQTYGMHIVQTPDKSWTNWSIARAWFTIRITWLDSSLSPNTFAFGVSPAAIMASSMPIPDG… |
| A0A7C1Q8P7 | 1-204 | IPAEAEFVLEGKVYLEERHAEGPFVDLTETYDMIREEPVFEVKKITHREDPIWQALLPGALEHKILMGMPREPTIFKKINESGVKCL… |
| A0A3S4GVC9 | 2-249 | None |
| A0A3S4JVF7 | 3-288 | None |
| A0A3R8PKP6 | 54-386 | None |
| A0A2V7KFM3 | 34-364 | None |
| A0A167NXY0 | 82-490 | None |
| A0A1A9VJK6 | 68-420 | None |
| A0A4U9H8Z9 | 35-320 | None |
| Q5AX16 | 70-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.