DPCstruct | MC9636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 123 ± 13 aa |
| Standard deviation of domain lengths | 13.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G2Q0X4 | 1-143 | MYEHAVAASALYNELVMAEACEALGLASEPRTVTAGRRPVMDIAGVPHELIRWTCRRGDQIAACLADLEHEYVTAIDDDGEPRFLPV… |
| A0A3N1HNY4 | 28-163 | LREVVAASELFNQRALELICDRLGLATEEVEVTPGQRPVMQVVGIDRRLRTAFAQRADAVRGMSETLFDDYRRCHGRQPGRPARTRL… |
| A0A1C5BDF9 | 138-268 | None |
| A0A543C3Z5 | 109-225 | None |
| A0A4R5A1W7 | 1-136 | None |
| A0A846LSN2 | 1-117 | None |
| A0A3N1UCD2 | 25-145 | None |
| A0A2S9PXW6 | 99-214 | None |
| A0A4R8Z5G5 | 17-143 | None |
| A0A0M4CP54 | 253-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.