DPCstruct | MC9633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 9.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A0AXB5 | 118-195 | AAIFEGLGNLLATSSRDWGTYRVDAWLYAVILGWDCEEATHNETCAHGAMEEMAALHGWDADTVAKARRYRAAVRDAL |
| I0CEC1 | 114-197 | LAAALSGLETLIVTSSRDWGTYRVDAWIWAVLVGWDCEEDQHNASCSHEALEGVAAAHGWTDDTVAKARRYHDAVRRLTAEAET |
| A0A1G9ATZ0 | 68-148 | None |
| A0A6I5D7R2 | 7-84 | None |
| F3ZD58 | 119-208 | None |
| A0A2W1TXX7 | 2-80 | None |
| A0A5N5W210 | 36-132 | None |
| A0A6G2P105 | 86-170 | None |
| A0A2W1Y8B3 | 11-118 | None |
| A0A1S6JGH8 | 174-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.