DPCstruct | MC9632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 292 ± 34 aa |
| Standard deviation of domain lengths | 34.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 15.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9S7Y5 | 27-272 | HMDAETTLLESSAFRWTVRIFGYTAMLYAAIVVLNTGPSGHEPLSPEYLNELVASLKSPALIAGISLPLLGLIASHLRSIQTKVQIE… |
| A0A3L7DLS7 | 4-249 | LSLLDVQFNPHRSFIALPIVWIVTLAIIITSSICAFLIVVHTPLRWDLSAAGFNNFVSVFRFPLGILALIIPIIALLAANHRSEQTK… |
| Q87HR5 | 1-291 | None |
| A0A3D0CCF4 | 8-280 | None |
| A0A6N2WYI3 | 2-336 | None |
| A0A4Y9TI64 | 3-260 | None |
| A0A3D0C9H5 | 83-362 | None |
| A0A2N8QJI5 | 28-359 | None |
| A0A5P1QT80 | 32-343 | None |
| A0A7C8HTY5 | 5-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.