DPCstruct | MC9631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 370 ± 54 aa |
| Standard deviation of domain lengths | 53.98 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B5GKY2 | 9-229 | TEELREEQEYVSLLHDRLDTLRNEAERDVARAVRPQGTGHQARVERDVGVAERTDRLAALDAVGSGLCFGRIDLRDGTRHHIGRAGI… |
| K8E5C6 | 5-393 | TDEFNYEQERVDWTVAQMVKREAILTSSVENVREEAQAIRSNFWKDVTVNVSEPDDVIETEVSIRQQELLLQERELNYKHVEKQLKA… |
| A0A7J0D6M9 | 1-380 | None |
| A0A329UCT4 | 361-697 | None |
| A0A840VYP4 | 12-403 | None |
| D4KVF5 | 229-599 | None |
| A0A2G7D6A9 | 11-384 | None |
| A0A511N8K0 | 16-407 | None |
| A0A397S2F5 | 307-722 | None |
| C9CGZ0 | 3-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.