DPCstruct | MC9630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 124 |
|---|---|
| Mean domain length (aa) | 139 ± 32 aa |
| Standard deviation of domain lengths | 31.71 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.93 |
| Pfam Score | 52.73 |
| Assigned Pfam label(s) | CL0023- PF17760- PF17755 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K8E2T1 | 4-131 | FITIKGARTNNLKNISLTIPKHKITVATGVSGSGKSSLIFDTLAAEFQHLLNDTYSSYIQQLLPHYAQPVVDEIENLPVSIVINQKK… |
| A0A5C7G900 | 20-123 | RYIEIKGASENNLKKVNAKFPLGTFTAVTGVSGSGKSTLVNEILHKALAQKLHKAKAKPGSHKEIKGLDHLDKVIDIDQAPIGRTPR… |
| A0A3D3XTX0 | 2-127 | None |
| A0A5C8DXN9 | 2-187 | None |
| A0A0G1V041 | 4-116 | None |
| M6GF69 | 2-122 | None |
| W1WLJ0 | 2-160 | None |
| A0A0C2MFT4 | 841-997 | None |
| A0A3M2C672 | 6-137 | None |
| A0A6I7YHP0 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.